PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 321aa    MW: 36473.9 Da    PI: 7.7576
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw +yl
   XP_013607182.1 14 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.22.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
   XP_013607182.1  67 RGKFNLQEEQTIIQLHALLGNR-WSSIATHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-25663IPR009057Homeodomain-like
PROSITE profilePS5129418.705961IPR017930Myb domain
SuperFamilySSF466891.61E-3011108IPR009057Homeodomain-like
SMARTSM007177.2E-161363IPR001005SANT/Myb domain
PfamPF002495.6E-171461IPR001005SANT/Myb domain
CDDcd001671.44E-111661No hitNo description
PROSITE profilePS5129425.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2564117IPR009057Homeodomain-like
SMARTSM007174.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.09E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRSPYCDKL GLKKGPWTPE EDQKLLAYIE EHGHGSWRSL PEKAGLHRCG KSCRLRWTNY  60
LRPDIKRGKF NLQEEQTIIQ LHALLGNRWS SIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKPKN ETPLGLSKNA ATLSHMAQWE SARLEAEARF ARESKLLHYQ TKPSSHHHHG  180
FTHKTLLTTW TTKTNQDQQQ LESPTSTVSF SDMKEPSNRV SAKMEFTGSS TGLALMKEHE  240
NDWISTTIFE ATQMEEGVEE GFTGLLLGGD TLGRSFSADK NERDGENSGG ECNNYFEDNK  300
NYLDSIFNFV GPSPSDAPPM F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533460.0AK353346.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-F01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607182.10.0PREDICTED: myb-related protein Hv1
TrEMBLA0A0D3EFC30.0A0A0D3EFC3_BRAOL; Uncharacterized protein
STRINGBra008705.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-165myb domain protein 16